DPCfam | MC381259
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 112 ± 10 aa |
| Residues in low-complexity regions (%) | 18.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.79 |
| Average transmembrane regions | 3.49 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| S3XXC2 | 1-110 | 110 | MHTFMMIFVFLHILCWAGAFGMWIAAAKNRQPRPGMAHMAAAAPVFGLIAALIGIAADMGINHMVIGIKLVLSVIVAVCAFIAIK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5HQJ2-F1 | 2-119 | 91.30 | 80.18 | View in AlphaFoldDB ↗ |