DPCfam | MC380556
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 52 ± 8 aa |
| Residues in low-complexity regions (%) | 7.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.54 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08843 |
| Sequences matching dominant architecture (%) | 79.17 |
| Average overlap percent | 27.47 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A101JAU2 | 1-58 | 58 | MKLPDLHRRLLADALRAGDDYELALAGGYAVQAHGLVGRPSQDLDFATRHPASMTDIV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O66416-F1 | 6-53 | 84.48 | 97.02 | View in AlphaFoldDB ↗ |