DPCfam | MC380478
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 61 ± 9 aa |
| Residues in low-complexity regions (%) | 0.29 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.12 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04552 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 38.53 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B8QDC3 | 412-477 | 66 | NLLKVARCIVRRQQGFFEHGATAMQPMVLRDVAEEVDLHESTVSRITTSKTMLTPRGLFSLKYFFS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O08429-F1 | 350-413 | 98.46 | 87.72 | View in AlphaFoldDB ↗ |