DPCfam | MC380278
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 191 ± 28 aa |
| Residues in low-complexity regions (%) | 15.22 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 39.31 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF03715 |
| Sequences matching dominant architecture (%) | 1.0 |
| Average overlap percent | 0.85 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F7S9L3 | 11-168 | 158 | HAQDLEKLKEKDPEFYAYLQENDKELLQFAETGPQRVTLKMLAGWQKSMLTHRSLKALRRLLIAFRCAVKPEEEDKRPEGASFII... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2HK47-F1 | 119-294 | 99.44 | 69.01 | View in AlphaFoldDB ↗ |