DPCfam | MC380235
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 115 ± 17 aa |
| Residues in low-complexity regions (%) | 1.03 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.4 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07712 |
| Sequences matching dominant architecture (%) | 91.67 |
| Average overlap percent | 50.08 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A061R5V9 | 316-445 | 130 | CVSPMRWSLTWPYDGRVVFAKGHLHTGGIDLSLYRATAAGGEELLCRTAARYGSGWGGNRTGAEGESPREPADQPAGNELGYVVG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0G8Z9-F1 | 281-402 | 99.20 | 95.31 | View in AlphaFoldDB ↗ |