DPCfam | MC379826
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 109 ± 20 aa |
| Residues in low-complexity regions (%) | 3.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 38.58 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01778 |
| Sequences matching dominant architecture (%) | 96.26 |
| Average overlap percent | 91.92 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G0QSV0 | 12-129 | 118 | SQLHWELVKNFNCYQLKNFGQKFTKDPYSLTGKNTFYGSGFLHLSGLALNKGEKSTVVASLRKNQTHKKVRKSGNLEGAQLNVKS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7PQX0-F1 | 7-126 | 100.00 | 92.70 | View in AlphaFoldDB ↗ |