DPCfam | MC379188
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 78 ± 9 aa |
| Residues in low-complexity regions (%) | 3.07 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.4 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03573 |
| Sequences matching dominant architecture (%) | 99.57 |
| Average overlap percent | 23.16 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A139SUD5 | 29-105 | 77 | LLASPAGWADFIGDKKITLSTTNLYFNRDYRSGPDDRKEWGQGFALNARSGYTEGTVGVGIDAIGWFAVKLDSGSGR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-G3XDA5-F1 | 22-97 | 97.44 | 90.41 | View in AlphaFoldDB ↗ |