DPCfam | MC379137
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 317 ± 70 aa |
| Residues in low-complexity regions (%) | 15.86 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 49.6 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14603- PF14603 |
| Sequences matching dominant architecture (%) | 50.91 |
| Average overlap percent | 88.28 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1A7YMD2 | 111-411 | 300 | EMYEDLEERWEEADRQDKKKEDKEEKKRQEAAKKEQKERERKEQDAKKKFKLVGPLVVIQKGKSLSDCRGGKMDLTMKQGEHLDI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3ZIE4-F1 | 451-812 | 99.43 | 69.40 | View in AlphaFoldDB ↗ |