DPCfam | MC379108
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 160 ± 24 aa |
| Residues in low-complexity regions (%) | 2.82 |
| Residues in coiled-coil regions (%) | 9.6 |
| Predicted disordered residues (%) | 31.75 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C7BY47 | 354-495 | 142 | LAVYGYDQQPITSIEFARQNKDAAFNAIFNIDLLQTSCKSYGLDFAHRVICFPGLKTVRILGTQEKMVNILIEPKKASYEERVLK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O29043-F1 | 61-146 | 46.59 | 93.64 | View in AlphaFoldDB ↗ |