DPCfam | MC378788
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 76 ± 9 aa |
| Residues in low-complexity regions (%) | 2.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.85 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09859 |
| Sequences matching dominant architecture (%) | 87.5 |
| Average overlap percent | 10.26 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000651453F | 25-82 | 58 | DWDAFATELEHYGCSVLKNILTPKKCSDIATLYPQEEHFRSHIRMARYGVGDFNCLHQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F178-F1 | 13-94 | 97.62 | 97.12 | View in AlphaFoldDB ↗ |