DPCfam | MC378255
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 225 ± 27 aa |
| Residues in low-complexity regions (%) | 2.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 9.53 |
| Average transmembrane regions | 0.15 |
| Dominant Pfam architecture(s) | PF12030 |
| Sequences matching dominant architecture (%) | 72.11 |
| Average overlap percent | 30.14 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S7H457 | 2-198 | 197 | VRDENLRFMRNRDVYNSDYFSFILSLASVNATKLKHQNYQPMAKESLQLAVHFLFHTYLHTKKKLRVDTEEWMAAVEVLLSKSSE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q93008-F1 | 1983-2212 | 99.10 | 85.18 | View in AlphaFoldDB ↗ |