DPCfam | MC378193
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 154 ± 25 aa |
| Residues in low-complexity regions (%) | 5.9 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 36.56 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A060T301 | 57-187 | 131 | GRLGEAPENFKPNFANPFDERILRLFEPNRQFITVLHSTIKNHIHNCPMFSALAAAEAKDSAFFHIYDLRNPPVYGRIPEVEDII... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2G383-F1 | 34-210 | 98.65 | 83.52 | View in AlphaFoldDB ↗ |