DPCfam | MC378176
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 63 ± 7 aa |
| Residues in low-complexity regions (%) | 1.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.94 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G1KHP1 | 40-97 | 58 | LCPVTRIGQDDLPGYDLISQFQLDKAASRGIIQRVVGSTALQVAYKLGTTVDFRIPTR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P20849-F1 | 41-100 | 96.83 | 86.93 | View in AlphaFoldDB ↗ |