DPCfam | MC377989
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 145 ± 17 aa |
| Residues in low-complexity regions (%) | 2.79 |
| Residues in coiled-coil regions (%) | 24.96 |
| Predicted disordered residues (%) | 23.78 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I7FL33 | 352-520 | 169 | VQEMMSQVFKKLGQDHEQQEKRLKLQLSELEKKKDTLERRYAYGEINGEIFSKFSGELKGEMGEIEVNMEKLSGPLSNHKTLLGK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P77658-F1 | 141-198 | 39.46 | 88.49 | View in AlphaFoldDB ↗ |