DPCfam | MC377719
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Residues in low-complexity regions (%) | 0.58 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.49 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14424 |
| Sequences matching dominant architecture (%) | 89.92 |
| Average overlap percent | 65.21 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A3B9319 | 26-91 | 66 | LGDLVDRNIDTEYKILTEIAEKLGKNVNATGKIRLFTERAPCNSCSNVIELFSKKYQKLEIEIIHN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0ET81-F1 | 412-469 | 95.24 | 91.95 | View in AlphaFoldDB ↗ |