DPCfam | MC377681
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 99 ± 9 aa |
| Residues in low-complexity regions (%) | 2.73 |
| Residues in coiled-coil regions (%) | 32.05 |
| Predicted disordered residues (%) | 31.13 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09325 |
| Sequences matching dominant architecture (%) | 6.9 |
| Average overlap percent | 66.01 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V8SGA8 | 521-622 | 102 | LFGRLTYAIQGVTDADPQRARQDALGKTKESLVHLEEALEVSRRDVKDVSQGVMEELRRFQVDKEGDLEGYMLNFARAHVEWSKR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CZJ4-F1 | 520-620 | 98.06 | 86.15 | View in AlphaFoldDB ↗ |