DPCfam | MC377483
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 601 |
|---|---|
| Mean domain length (aa) | 110 ± 14 aa |
| Residues in low-complexity regions (%) | 2.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.65 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00464 |
| Sequences matching dominant architecture (%) | 97.67 |
| Average overlap percent | 37.0 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V2B3U3 | 293-406 | 114 | KNYADMIVANAKLLSGALEKNGFQVLTNGKSFTDTHQILFNLPGHLSHYEISRKLLECHISTNAKHVYERDVVRIGVQELTRLGM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q67N41-F1 | 285-407 | 100.00 | 98.25 | View in AlphaFoldDB ↗ |