DPCfam | MC377345
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 58 ± 3 aa |
| Residues in low-complexity regions (%) | 0.33 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.8 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10433 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 18.09 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L0VWG3 | 13-71 | 59 | DYIILGSDSGRVLVLKFNPSTNSLIKLHQETCGKSVAGRVVPGQFLATNPKGRAVMIAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A158Q3Y2-F1 | 77-135 | 100.00 | 95.50 | View in AlphaFoldDB ↗ |