DPCfam | MC37725
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Residues in low-complexity regions (%) | 6.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.6 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00378 |
| Sequences matching dominant architecture (%) | 88.64 |
| Average overlap percent | 27.53 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1R4HGZ4 | 459-556 | 97 | LSTQEAKHIGLIDVTLPDYFAAFDTKVKTMAEALAQHKNYDKILKSKIQRRNQDEFLKPLQYYREEEQRRMKEEFFESEALYHLI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P31907-F1 | 440-551 | 100.00 | 96.78 | View in AlphaFoldDB ↗ |