DPCfam | MC377151
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 268 ± 30 aa |
| Residues in low-complexity regions (%) | 1.69 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.45 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF00723 |
| Sequences matching dominant architecture (%) | 96.84 |
| Average overlap percent | 35.53 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H3EGN7 | 416-704 | 289 | ILPECYYVDEVNAEEEKKRGGTDLTPVYLSYHYCLICSLLEVSPSEFGHHLWSNAVYIILLLLRDNLIHSGDLDPINRRMPASQR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P12798-F1 | 385-671 | 99.63 | 87.47 | View in AlphaFoldDB ↗ |