DPCfam | MC377131
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 291 |
|---|---|
| Mean domain length (aa) | 263 ± 46 aa |
| Residues in low-complexity regions (%) | 5.62 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 27.61 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF06025 |
| Sequences matching dominant architecture (%) | 96.79 |
| Average overlap percent | 60.45 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1Q8RSF3 | 801-1039 | 239 | LAQGILSSSDAINVVPQVLNSICLNNNGMKMVVSSRALELFLDIFESPIHVNTMEADPHLASNVGASFDELARHHPALRRPISNA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A2R8QKJ2-F1 | 586-865 | 99.23 | 73.85 | View in AlphaFoldDB ↗ |