DPCfam | MC376755
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 417 ± 71 aa |
| Residues in low-complexity regions (%) | 4.74 |
| Residues in coiled-coil regions (%) | 0.09 |
| Predicted disordered residues (%) | 19.45 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF05053 |
| Sequences matching dominant architecture (%) | 67.31 |
| Average overlap percent | 83.35 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F7DC63 | 215-562 | 348 | RGAVDLSCYPREDGVSGRELIRRVSDVIWNGLSRSYFKDRAHIQSLFSFVTGTKLDSPGVAFAVVAACQVLGLSDVHLALSEDHA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O88559-F1 | 32-457 | 99.74 | 94.57 | View in AlphaFoldDB ↗ |