DPCfam | MC376595
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 105 ± 14 aa |
| Residues in low-complexity regions (%) | 0.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.35 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13768 |
| Sequences matching dominant architecture (%) | 87.18 |
| Average overlap percent | 8.82 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0008FA66D3 | 117-220 | 104 | SNEPHSPLVILERGRLTFSEYEQQIHTRRDFIRCAQKEAESEKMLEFVRRRYHKDLLLNPVLMLNFCPDLLSEPTELQQASRELI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5TIE3-F1 | 281-382 | 100.00 | 86.43 | View in AlphaFoldDB ↗ |