DPCfam | MC376205
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 115 ± 11 aa |
| Residues in low-complexity regions (%) | 4.26 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 37.44 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16727 |
| Sequences matching dominant architecture (%) | 0.86 |
| Average overlap percent | 2.3 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0K6GDA3 | 14-124 | 111 | AGDVFTCQGNGLMYENITRVPIDELRQLLAAGSGQTLAGNRKESKKWFQAQCAHYGLPVKGVIAALRAQLDTFVTSPAASVPEDI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WEL7-F1 | 7-116 | 98.28 | 55.47 | View in AlphaFoldDB ↗ |