DPCfam | MC37556
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 104 ± 8 aa |
| Residues in low-complexity regions (%) | 4.93 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.96 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1A7RC41 | 14-120 | 107 | AVLTVGLSSAAMAEKSQSLSQKMLKPVIEYQCGQELNASKVWKGASMFMSAAQKKDNQTAICQCVSEHAMDEMTAKDLMTAAVSE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5F8S0-F1 | 26-120 | 86.49 | 80.30 | View in AlphaFoldDB ↗ |