DPCfam | MC375238
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 106 ± 9 aa |
| Residues in low-complexity regions (%) | 9.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.61 |
| Average transmembrane regions | 2.77 |
| Dominant Pfam architecture(s) | PF06166 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 46.77 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F1DPA1 | 9-109 | 101 | LEFFFVLSGLIFFYSAYQSAQDTSNPKRLGTAAFWAILGILFVFGRLLPGLFSGILVVLLGAITLFKQFGAGTGFVEDKKKQDLA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GQ06-F1 | 7-119 | 98.11 | 84.77 | View in AlphaFoldDB ↗ |