DPCfam | MC375056
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 58 ± 7 aa |
| Residues in low-complexity regions (%) | 1.29 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.7 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14281 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 27.84 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R6Q0B3 | 13-76 | 64 | LKEFLLDISCLDQLAEWSDSFNLFDVLKITRVEIRHSNMLAWLLDPNENHGLEKNILEEFICFA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0PC95-F1 | 19-67 | 83.33 | 90.94 | View in AlphaFoldDB ↗ |