DPCfam | MC374866
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 551 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Residues in low-complexity regions (%) | 2.22 |
| Residues in coiled-coil regions (%) | 0.05 |
| Predicted disordered residues (%) | 28.15 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04824 |
| Sequences matching dominant architecture (%) | 98.86 |
| Average overlap percent | 58.92 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0005815D2A | 1194-1270 | 77 | FTENTGWSSRTRAVSKYLQTLFVKEAEHGSKSLSMNNLLSGKSRKEASRMFFEALVLKTRDYVHVEQQNPFDDITIK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q550H7-F1 | 719-808 | 97.65 | 85.11 | View in AlphaFoldDB ↗ |