DPCfam | MC374646
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 3271 |
|---|---|
| Mean domain length (aa) | 156 ± 15 aa |
| Residues in low-complexity regions (%) | 12.06 |
| Residues in coiled-coil regions (%) | 0.11 |
| Predicted disordered residues (%) | 0.86 |
| Average transmembrane regions | 4.22 |
| Dominant Pfam architecture(s) | PF01098 |
| Sequences matching dominant architecture (%) | 99.79 |
| Average overlap percent | 48.24 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0T5ZQY5 | 11-149 | 139 | DWLFFFIVILICIIGLVNLFSASYQTGLSVFKKQLVWFTLGVVVAACISFFDHRSLERYSHHIYVFSVLLLIAALIFGKEVSGSK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q39YM0-F1 | 18-177 | 97.73 | 90.94 | View in AlphaFoldDB ↗ |