DPCfam | MC374458
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 98 ± 7 aa |
| Residues in low-complexity regions (%) | 6.45 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.79 |
| Average transmembrane regions | 0.96 |
| Dominant Pfam architecture(s) | PF03631 |
| Sequences matching dominant architecture (%) | 96.77 |
| Average overlap percent | 17.81 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A01047B | 453-550 | 98 | LQTFGGILVAHQLRHSTQVYGFFGTVLGLISWLYLAARITMYAAEVNVVRARRLWPRSLTQPPLTRADREVLDALVRQEERRPEQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2FX10-F1 | 296-334 | 40.62 | 89.48 | View in AlphaFoldDB ↗ |