DPCfam | MC374267
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 94 ± 19 aa |
| Residues in low-complexity regions (%) | 15.3 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 52.54 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11357 |
| Sequences matching dominant architecture (%) | 53.33 |
| Average overlap percent | 7.42 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004ED083C | 11-107 | 97 | EKQCPQLSTTVASPEVLVVDGEVPGLSEPRVETSPRPPSTSVKRKRDAEDDLEELVIPEPQPVWVVETLCWLKKKMKRQCVFTVL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A6NKU9-F1 | 10-112 | 96.30 | 33.92 | View in AlphaFoldDB ↗ |