DPCfam | MC374142
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 100 ± 10 aa |
| Residues in low-complexity regions (%) | 3.88 |
| Residues in coiled-coil regions (%) | 39.29 |
| Predicted disordered residues (%) | 33.93 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H2MKX8 | 666-751 | 86 | VDRLLKEMSLCLLDLQALCNILVQRAQGEEPNLSLLLGIKSEEIDCRVEEEEELSVKLLEVCRLRKGIDELRRNISERCDHFLGN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F7EXF4-F1 | 711-805 | 96.04 | 75.42 | View in AlphaFoldDB ↗ |