DPCfam | MC374069
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 96 ± 12 aa |
| Residues in low-complexity regions (%) | 6.64 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.87 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09203 |
| Sequences matching dominant architecture (%) | 98.41 |
| Average overlap percent | 36.83 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000934548E | 69-143 | 75 | VSGNGWNLTVTQSDTVVNSVVPLNSTPWDKDLFVSGLNHAEISGSGDDKITKSTLEVGYEFGFQFDISSGLTLGI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0ETX7-F1 | 2-94 | 89.32 | 86.19 | View in AlphaFoldDB ↗ |