DPCfam | MC37403
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 152 ± 25 aa |
| Residues in low-complexity regions (%) | 2.32 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 37.8 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08758- PF00028 |
| Sequences matching dominant architecture (%) | 73.81 |
| Average overlap percent | 72.93 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| P10288 | 42-191 | 150 | PEDVHSAVVSRSVHGGQPLLNVRFQSCDENRKIYFGSSEPEDFRVGEDGVVYAERSFQLSAEPTEFVVSARDKETQEEWQMKVKL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1PAA9-F1 | 32-197 | 100.00 | 75.71 | View in AlphaFoldDB ↗ |