DPCfam | MC373815
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 358 ± 29 aa |
| Residues in low-complexity regions (%) | 17.71 |
| Residues in coiled-coil regions (%) | 10.7 |
| Predicted disordered residues (%) | 32.96 |
| Average transmembrane regions | 0.24 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00078197F7 | 3-389 | 387 | LDTTIHGDPESIHDLADWLDNVKSAIKTADVQMTWVATEASYAWSGSAAMAFHEAVQALRRSQFPVADYLRDAVEVFRSYANRLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P45931-F1 | 706-807 | 25.14 | 22.39 | View in AlphaFoldDB ↗ |