DPCfam | MC373759
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 103 ± 11 aa |
| Residues in low-complexity regions (%) | 4.46 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.85 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04187 |
| Sequences matching dominant architecture (%) | 98.21 |
| Average overlap percent | 30.41 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q221E2 | 182-284 | 103 | SGPALQAQQEKVRVGHCNLLPESQIAPMTRVQIARDVAMAQTVARAALRGKIVLLLAGGGHVDRSLGVPLHLPPDLTVKTVLLQA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HV92-F1 | 181-279 | 98.06 | 97.18 | View in AlphaFoldDB ↗ |