DPCfam | MC373472
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 1136 ± 268 aa |
| Residues in low-complexity regions (%) | 2.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.18 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF02368 |
| Sequences matching dominant architecture (%) | 25.0 |
| Average overlap percent | 4.83 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W4YXF0 | 11-1421 | 1411 | LSLFFFAALVAHLPHCATGTSRLNIPKVLLPLARSTRINFTLEATDGCYKWSSTRPEVANIESVDAIEVADQLCSQRAILQARST... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8TEM1-F1 | 28-1288 | 100.00 | 82.44 | View in AlphaFoldDB ↗ |