DPCfam | MC37329
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 341 |
|---|---|
| Mean domain length (aa) | 60 ± 6 aa |
| Residues in low-complexity regions (%) | 0.68 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11645 |
| Sequences matching dominant architecture (%) | 0.81 |
| Average overlap percent | 54.51 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B3E8A2 | 8-71 | 64 | RVSREQLYEEVWAEPMTTVALKYKVSSSFLARICTRLKVPRPQRGYWAMYATGKRPNKPPLPAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-U7Q0S5-F1 | 134-151 | 28.57 | 91.45 | View in AlphaFoldDB ↗ |