DPCfam | MC373217
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 203 ± 23 aa |
| Residues in low-complexity regions (%) | 3.11 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 13.45 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01861 |
| Sequences matching dominant architecture (%) | 99.22 |
| Average overlap percent | 85.03 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| F6CNQ8 | 83-277 | 195 | TVTLQGSFPRVLKEFEEIVRQRPAAIAEFDQGYVDTMSTVARVAIMYQRGDLENQDILLIGDDDLTSIAIALTGMARHITVLEVD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q58088-F1 | 125-318 | 96.59 | 95.17 | View in AlphaFoldDB ↗ |