DPCfam | MC373188
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 164 ± 51 aa |
| Residues in low-complexity regions (%) | 3.3 |
| Residues in coiled-coil regions (%) | 0.04 |
| Predicted disordered residues (%) | 26.41 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08939 |
| Sequences matching dominant architecture (%) | 87.56 |
| Average overlap percent | 73.61 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G4EWD0 | 481-682 | 202 | PSQGAKHKRDTQYHYLWNEPTGENHYDIAKIQSRGLQILTDQAHGGKNTVIKERLLQLAAEMGCVAGKWMLHFDGENNLRTACAR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2DAN9-F1 | 188-424 | 100.00 | 81.58 | View in AlphaFoldDB ↗ |