DPCfam | MC373154
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 113 ± 20 aa |
| Residues in low-complexity regions (%) | 0.84 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 11.5 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03692 |
| Sequences matching dominant architecture (%) | 66.19 |
| Average overlap percent | 56.14 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0J8SP39 | 9-135 | 127 | FWKHYTLNELKPQEWEALCDGCGLCCLIKFEDEDTQEVTYTRVACKLLDCQTARCSDYPNRLQFVPDCIQLTPEKLAAIHWLPAS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B5BHE5-F1 | 12-117 | 97.25 | 94.85 | View in AlphaFoldDB ↗ |