DPCfam | MC373135
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 116 ± 11 aa |
| Residues in low-complexity regions (%) | 1.94 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.39 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00380 |
| Sequences matching dominant architecture (%) | 76.09 |
| Average overlap percent | 23.75 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0L7LJP0 | 39-132 | 94 | LTKEQLENVLVEAITDLEYDNFKLVMVRITSLPYAYRCKDFIEKYRKALAMQKKQARGDVTIRSPGTGNITINGKDITYFEDIQS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1QP17-F1 | 191-308 | 98.33 | 93.42 | View in AlphaFoldDB ↗ |