DPCfam | MC37296
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 121 ± 14 aa |
| Residues in low-complexity regions (%) | 8.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.78 |
| Average transmembrane regions | 1.0 |
| Dominant Pfam architecture(s) | PF15902- PF15901 |
| Sequences matching dominant architecture (%) | 2.63 |
| Average overlap percent | 57.5 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I3JQU3 | 818-939 | 122 | LSELLLSALNQNLVQFTLRPGVQVTVYAAHLSAAPLVDTSENHSGSAMLMLLSVVVVGLAVFVIYKFKRKIPGLNVYAQMQNEKE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D4A2I9-F1 | 871-1000 | 98.45 | 46.56 | View in AlphaFoldDB ↗ |