DPCfam | MC372705
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 108 ± 11 aa |
| Residues in low-complexity regions (%) | 2.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 18.03 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01867 |
| Sequences matching dominant architecture (%) | 56.47 |
| Average overlap percent | 66.45 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00037E8360 | 6-112 | 107 | TMRDLPKIRDSLSYLYFEYGHLEQSKLGVEFVNKQGSIPVPVASLAALLLGPGTTVTHGAIRTVAEAGCSIVWCGEQGVRCYAQG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6D0X0-F1 | 11-132 | 98.18 | 90.59 | View in AlphaFoldDB ↗ |