DPCfam | MC372476
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 263 ± 42 aa |
| Residues in low-complexity regions (%) | 11.46 |
| Residues in coiled-coil regions (%) | 0.14 |
| Predicted disordered residues (%) | 30.25 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01636 |
| Sequences matching dominant architecture (%) | 12.12 |
| Average overlap percent | 61.32 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00099DC653 | 61-328 | 268 | YTWWHGPGPLRPDPLAAPLAAYVPRHTPGARLAVPRPRAAGLVHLADGAHSAAAWLRDPRPQARTLVAHALAAAGRALRTLHTTP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F2E5-F1 | 88-201 | 43.68 | 95.60 | View in AlphaFoldDB ↗ |