DPCfam | MC372233
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 411 ± 29 aa |
| Residues in low-complexity regions (%) | 3.79 |
| Residues in coiled-coil regions (%) | 5.31 |
| Predicted disordered residues (%) | 18.35 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF13181 |
| Sequences matching dominant architecture (%) | 1.79 |
| Average overlap percent | 14.6 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q2T8N1 | 7-395 | 389 | TNPVERRFMDAHTDWQRFAKDRAARLMIWQTNEADAQLVQLYFQTQEEMSSAVRVMRSEFVDGAHYAPALTDELIRFYDSRREAS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q96AY4-F1 | 532-697 | 40.14 | 87.75 | View in AlphaFoldDB ↗ |