DPCfam | MC372098
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 681 |
|---|---|
| Mean domain length (aa) | 108 ± 21 aa |
| Residues in low-complexity regions (%) | 1.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.11 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14021 |
| Sequences matching dominant architecture (%) | 94.82 |
| Average overlap percent | 80.38 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W9EXX8 | 36-135 | 100 | NDGALRPVKVSILNPGELIDRYGYPGGKYTSPIGTPYSMRAPAPGTETKPYTVYEVMKPIPRVLESKIAPWFGEIGLGTQYLLPE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VZ57-F1 | 126-230 | 92.52 | 96.69 | View in AlphaFoldDB ↗ |