DPCfam | MC371717
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 160 ± 22 aa |
| Residues in low-complexity regions (%) | 3.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.11 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0009A5335E | 35-175 | 141 | RDGVLAGGAGLSATGTSAMQVQIGTGRAIVQGTSVQGAYPVAITAPVTLTVPDGHAQHPRIDAVVLRVIDTLYETALQDTVQLEI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A5P3FWD9-F1 | 32-153 | 80.13 | 94.42 | View in AlphaFoldDB ↗ |