DPCfam | MC371627
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 311 |
|---|---|
| Mean domain length (aa) | 106 ± 17 aa |
| Residues in low-complexity regions (%) | 9.79 |
| Residues in coiled-coil regions (%) | 0.05 |
| Predicted disordered residues (%) | 1.07 |
| Average transmembrane regions | 2.74 |
| Dominant Pfam architecture(s) | PF03155 |
| Sequences matching dominant architecture (%) | 98.95 |
| Average overlap percent | 29.68 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0N8BC71 | 169-278 | 110 | LSKIGPKTTLVFTILAILPAVVILLKQPNQPRVFIRAIVLCAFASFLFGWHVHEKAILIVITPLTLLAVSSQEDCRLFMLLSITG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q566T2-F1 | 323-433 | 99.10 | 94.98 | View in AlphaFoldDB ↗ |