DPCfam | MC371509
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 144 ± 9 aa |
| Residues in low-complexity regions (%) | 7.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.18 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00071- PF00651 |
| Sequences matching dominant architecture (%) | 54.35 |
| Average overlap percent | 50.79 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A3148CE | 156-303 | 148 | VTTTEGIQLAKELGATYLELHSLDDFYIGKYFGGVLEYFMIQALNQKTSEKMKKRKMTSSFHGIRPPQLEQPEKMPVLKAEASHY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0G2JWZ1-F1 | 160-299 | 97.16 | 89.81 | View in AlphaFoldDB ↗ |